Faktor Patentbureau is Other Commercial Services in Iceland that focus on commercial law business. Founded in 1969. They cover business area such as operator, an intellectual property firm, Reykjavik, Iceland, intellectual property law, service, patent, trademark, design, copyright law, domain name, licensing, franchising, both competition, commercial law.
1969
( 57 years old in 2026 )
Commercial Law
-
Sólvallagata 48
Reykjavík, 101
Iceland
Private
operatoran intellectual property firmReykjavikIcelandintellectual property lawservicepatenttrademarkdesigncopyright lawdomain namelicensingfranchisingboth competitioncommercial law
* We use standard office opening hours in near Faktor Patentbureau's location as default value for unknown and outdated data. For more valid info, please verify the info from more trusted sources like GoogleMyBusiness, Yelp, FourSquare or similar services.
Faktor Patentbureau is Other Commercial Services business from Iceland that founded in 1969 (57 years old in 2026), Faktor Patentbureau business is focusing on Commercial Law.
Faktor Patentbureau headquarter office and corporate office address is located in Sólvallagata 48 Reykjavík, 101 Iceland.
Faktor Patentbureau was founded in Iceland.
In 2026, Faktor Patentbureau is currently focus on commercial law sector.
Above is snippet of Google Trends for "commercial law" term, if you have problem loading the snippet, please visit here: Google Trend.
Disclaimer: This website is not affiliated with Faktor Patentbureau, any government agency, does not create this data, vouch for its accuracy, or guarantee that it is the most recent data available. The data displayed is available through open government websites and public online directory. This website expressly disclaims the accuracy, adequacy, or completeness of any data and shall not be liable for any errors, omissions or other defects in, delays or interruptions in such data, or for any actions taken in reliance thereon.
